Work wellbeing score is 78 out of 100
4.2 out of 5 stars.
Write a review

Southwest Airlines Employee Reviews

Review this company
Job Title
All
Location
United States2,895 reviews

Ratings by category

3.9Work-Life Balance
4.3Pay & Benefits
4.0Job Security & Advancement
3.6Management
4.2Culture

Sort by

HelpfulnessRatingDate
Found 2,895 reviews matching the searchSee all 2,912 reviews
airlineflightswapassengertravelrampflyingculture

challenging enviroment

Indeed Featured review

The most useful review selected by Indeed
great environment. Learned to work as a team and in a diverse culture. Management is helpful, and easy to get along with. The best thing about working here is the perks and the people and sense of accomplishment.
Was this review helpful?

This company you will get what you put into it

At this job, it can be a great place to work if you do as you were told by the book of procedures. I learned that if you do your job to the full extent of your ability, your day will go smoothly... Southwest airlines is a company that treats you like family.. The hardest part of my job is the weather. The most enjoyable about my job is the people...

Pros

The benefits.

Cons

The weather can be distrubing
Was this review helpful?

Jobs at Southwest Airlines

See more jobs

Great company to work for!

Good benefits, culture, and positive work environment. The only thing I would say is that we are not the most competitive in the pay category but otherwise great place to be.
Was this review helpful?

Love the company HATE my station

What is the best part of working at the company?Meeting new people traveling!!What is the most stressful part about working at the company?EVERYTHING depending on the station What is the work environment and culture like at the company?It is awful! Managers and supervisors threaten jobs constantly especially new hires, they love bullying new hires. What is a typical day like for you at the company?Completely stressful due to the lack of respect you get from management and supervisors
Was this review helpful?

Not good

SouthWest are jerks to say the least. Poor working conditions and terrible training. You are just a number there no matter the position. Absolute joke of a company
Was this review helpful?

Southwest Airlines insights

Based on 1,550 survey responses
What people like
  • Feeling of personal appreciation
  • Ability to learn new things
  • Clear sense of purpose

Fun place to work/Flight benefits

Being a Flight Attendant with SWA is great based off of the flexibility. You can give away your entire board or work as much as you want. Flexibility alone makes this job worth it!
Was this review helpful?

Nepotism taken to the highest level. Extremely cliquish

As a former Ramp Agent at LGA i can honestly say that the high points this company professes to espouse and celebrate are highly contrary to what actually happens when you are 'on the ground' and working. The supervisors are all extremely clique-ish and the employee scramble for that coveted OT is ridiculously absurd. Everyone is literally out to screw the next one despite the whole "WE are like a family" nonsense that Southwest likes to espouse. I worked as a Ramp Agent and i will never go back to work for Southwest airlines again.

Pros

Out on your own...

Cons

payroll accounting deficiencies, un-trustworthy personalities
Was this review helpful?

Great experience

I would highly recommend flying with SWA for anyone. Young, old. Anyone! Southwest has an excellent commuter policy if you choose not to live in your base.
Was this review helpful?

Fun work place. Supervisors have less than 1 yr with company so you get alot of different answers to a question

Fun industry but the probation period is super long. It's hard to get a straight answer as many of the "leaders" haven't been with the company nearly as long as your coworker senior agents. It's best to learn from your coworkers
Was this review helpful?

the luv, appreciation and daily challenges,as well as opportunities to move around the company make it special.

What is the best part of working at the company?The culture, the fact that Southwest hires heart over skills.What is the most stressful part about working at the company?Delays and computer issues out of my control.What is the work environment and culture like at the company?You become part of a big family, our Culture is legendary. We work hard, and play hard. Our culture includes chili cook offs, Spirit parties, Rallies to name a few. Some positions are 100% remote, some are hybrid, others you have to be at the stations.What is a typical day like for you at the company?I work remotely on an internal support desk. I take inbound calls, solve problems, answer questions, fix reservations, operate 10 or more programs simultaneously. Serve as a subject matter expert to the agents at the airport as well as those on the 1800 line.
Was this review helpful?

Rate your recent company

Share your experience to help others

Great Culture and Benefits….but

In the Timekeeping Specialist role you will feel like you have a corporate job but with the schedule of an airport worker. The schedule is horrible. You will be working weekends and holidays. You will be dealing with issues that seemingly no one has the authority to improve or change. The workload is heavy especially if you’re being careful and trying to make sure you’re doing your job correctly. No benefit for doing a good job. Need to play the social game to find other opportunities in the company. Would not recommend as a long term job but good way to get your foot in the door.
Was this review helpful?

A workplace where I wanted to be.

What is the best part of working at the company?Great opportunities for growth and Southwest really values their employees.What is the most stressful part about working at the company?Being held over for mandatory overtime.What is the work environment and culture like at the company?Fun and energetic. I always liked going to work.What is a typical day like for you at the company?Always an emphasis on giving the customer the best experience possible while making sure the employees were taken care of.
Was this review helpful?

really happy to work again with SWA

What is the best part of working at the company?colleges are really helpful and domain learning is easy.What is the most stressful part about working at the company?no stress but automating 2 tc daily is some times not an easy task.What is the work environment and culture like at the company?very cooperative and understanding
Was this review helpful?

Fun!

Most fun job, be yourself and gives you opportunities to expand. If you love to travel things definitely the job for you I would recommend giving it a shot.
Was this review helpful?

They make you feel warm and fuzzy all while exploiting you at the same time.

I‘ve had pretty salty experiences since the first week. They advertised the job at $23.50/hr, but then in small print mentioned that it’s a base pay of roughly $20/hr, and a bonus that will be paid out every 3 months for 2 years. You also don’t get the full bonus if you’ve taken time off and the company can retract the bonus at any time they please. Just super deceptive any which way you cut it. Training supervisors don’t tell you your schedule until the Friday before your next week of training, and can change your schedule at any time. They want you to check your company email without compensating you for time, data, or WiFi used to do so. Around your second or third week in they make you go on a pointless trip to Dallas and is more like a glorified pep rally than it is actual training. The attendance policy makes no room for people who have kids as you’re only allowed to be absent/late 3 times in a 180 day probation. Once training is complete you pretty much have to start taking doubles if you want to be able to pay your bills. The job itself isn’t bad and can be fun depending on what you do and who you work with. It just feels like the job is overly demanding for what it pays.

Pros

Can sometimes be fun and has good health benefits.

Cons

Low pay, careless supervisors, limited advancement, and no tuition reimbursement. Basically just grooming and exploitation.
Was this review helpful?

good place to work

good people to work with. healthy environment for friendships! I wish it was easier to move up or around. Very competitive - good sign of the quality of the company!
Was this review helpful?

Good

Lots of down time, decent people to work with. The flight benefits are good but you can’t always utilize them starting out. Seniority based system for your hours.
Was this review helpful?

Great company, but terrible dealing with the public

The company is great, but dealing with the public is not so great. Great benefits, people were fun to work with, but wears you our dealing with passengers.
Was this review helpful?

Great place to work

Very fast paced, 30 minute lunches and 2 fifteen minute breaks. Great work like balance, flexible with time off. You would love working with the airline.
Was this review helpful?

SWA is not who they seem

SWA was unprofessional and had two faced management. They displayed clear bias against people some stations and the union did some blame-shifting instead of helping the people they were obliged to represent. Many supervisors were afraid they could lose their jobs at anytime because they have no coverage at all. The aircrafts and ground equipment’s limits would be pushed more than other air carriers. My favorite part of the job was clocking out and walking away from the station every night.

Pros

Benefits in healthcare and 401k

Cons

Not enough appreciation for people keeping SWA in business
Was this review helpful?

Best job I've ever had!

What is the best part of working at the company?Absolutely extraordinary company to work with and for.What is the most stressful part about working at the company?The unexpected delays and cancellations.What is the work environment and culture like at the company?Fantastic! The culture is supportive and you know you're part of an excellent team.What is a typical day like for you at the company?Long days, but they go fast. You work 3 days a week most weeks.
Was this review helpful?

Want to know more about working here?

Ask a question about working or interviewing at Southwest Airlines. Our community is ready to answer.Ask a Question

Overall rating

Based on 2,912 reviews

Ratings by category

3.9 out of 5 stars for Work/Life Balance
4.3 out of 5 stars for Compensation/Benefits
4.0 out of 5 stars for Job Security/Advancement
3.6 out of 5 stars for Management
4.2 out of 5 stars for Culture

Compare Southwest Airlines with

Compare
Compare
Compare
Compare
Compare
Compare
Compare
Compare
Compare
Compare

Questions about Southwest Airlines

Learn about popular job titles at Southwest Airlines

See all job titles at Southwest Airlines